Swine CXCL9 Recombinant Protein

$180.00

CXCL9 (MIG) is a T-cell chemoattractant. Induced by IFN-gamma (IFN-γ), the ELR-negative chemokine CXCL9 (MIG) elicits its effects by binding to the cell surface chemokine receptor CXCR3. Swine CXCL9 Recombinant Protein is purified CXCL9 (MIG) produced in yeast.

Catalog # Product Size Quantity Price
6470 5 µg $180.00
Catalog #: 6470 Category:

Chemokine (C-X-C motif) ligand 9 (CXCL9), also commonly known as monokine induced by interferon-gamma (MIG), is a small cytokine belonging to the CXC chemokine family and is closely related to two other ELR-negative CXC chemokines: CXCL10 and CXCL11.

There have been 17 different C-X-C chemokines described in mammals that are subdivided into two categories: those with a specific amino acid sequence (or motif) of glutamic acid-leucine-arginine (or ELR for short) immediately before the first cysteine of the C-X-C motif (ELR-positive), and those without an ELR motif (ELR-negative). ELR-positive C-X-C chemokines specifically induce the migration of neutrophils, and interact with chemokine receptors CXCR1 and CXCR2. C-X-C chemokines that lack the ELR motif are chemoattractant for lymphocytes.

CXCL9 (MIG) is a T-cell chemoattractant. Induced by IFN-gamma (IFN-γ), the ELR-negative chemokine CXCL9 (MIG) elicits its effects by binding to the cell surface chemokine receptor CXCR3.

The swine CXCL9/MIG protein can be used in cell culture, as a CXCL9/MIG ELISA Standard, and as a Western Blot Control.

• Protein Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDV KKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)
• Alias: MIG
• Source: yeast
• Molecular Weight: 12.1 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping

Han J, Gu MJ, Yoo I, Choi Y, Jang H, Kim M, Yun CH, Ka H. Analysis of cysteine-X-cysteine motif chemokine ligands 9, 10, and 11, their receptor CXCR3, and their possible role on the recruitment of immune cells at the maternal-conceptus interface in pigs. Biol Reprod. 2017 Jul 1;97(1):69-80. doi: 10.1093/biolre/iox074. Abstract

“The inserts were preincubated in RPMI 1640 containing 5% FBS for 1 h. Media were removed, and the inserts were then placed into wells containing 500 μl media containing different doses (0, 2, 5, 10, 30, or 90 ng/ml) of the recombinant porcine chemokines CXCL9 (rCXCL9), CXCL10 (rCXCL10), and CXCL11 (rCXCL11) (all from Immunochemistry Technologies, Bloomington, MN).”