Canine IL-2 Recombinant Protein

$180.00

Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Canine IL-2 Recombinant Protein is purified interleukin-2 produced in yeast.

Catalog # Product Size Quantity Price
6429 5 µg $180.00
Catalog #: 6429 Category:

Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response.

IL-2 was discovered to be a member of a family of cytokines, which also includes IL-4, IL-7, IL-9, IL-15 and IL-21. IL-2 signals through a receptor complex consisting of IL-2 specific IL-2 receptor alpha (CD25), IL-2 receptor beta (CD122) and a common gamma chain (γc). All members of this family use the common gamma chain as part of their signaling complex.

The Canine IL-2 protein can be used in cell culture, as an IL-2 ELISA Standard, and as a Western Blot Control.

• Protein Sequence: APITSSSTKETEQQMEQLLLDLQLLLNGVNNYENPQLSRMLTFKFYTPKKATEFTHLQCL AEELKNLEEVLGLPQSKNVHLTDTKELISNMNVTLLKLKGSETSYNCEYDDETATITEFL NKWITFCQSIFSTLT (135)
• Alias: Interleukin-2
• Source: yeast
• Molecular Weight: 15.5 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping