Bovine IL-1F5 Recombinant Protein

$180.00

IL-1F5 is a member of the interleukin-1 family of cytokines, which holds a central role in the development and regulation of immune and inflammatory responses. Also known as IL-36 receptor antagonist (IL-36ra), IL-1F5 reduces inflammation by blocking the binding of the agonist receptor ligands. Bovine IL-1F5 Recombinant Protein is purified interleukin-1F5 produced in yeast.

Catalog # Product Size Quantity Price
6406 5 µg $180.00
Catalog #: 6406 Category:

The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1 cytokines play key roles in the development and regulation of inflammation. IL-1α (IL-1F1), IL-1β (IL-1F2), and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an ‘alarmin’ released following cell necrosis to alert the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation. The Bovine IL-1F5 protein can be used in cell culture, as an IL-36RA ELISA Standard, and as a Western Blot Control.

The Bovine IL-36RA/IL-1F5 protein can be used in cell culture, as an IL-36RA ELISA Standard, and as a Western Blot Control.

• Protein Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILG VHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWF LCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD (155)
• Alias: IL-36Ra
• Source: yeast
• Molecular Weight: 17.1 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping