Bovine IL-17A Recombinant Protein

$180.00

IL-17A is a member of the IL-17 family of cytokines, whose members are involved in numerous immune regulatory functions. IL-17 induces the production of many other cytokines, chemokines, and prostaglandins. Bovine IL-17A Recombinant Protein is purified interleukin-17A produced in yeast.

Catalog # Product Size Quantity Price
6388 5 µg $180.00
Catalog #: 6388 Category:

Bovine IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces the production of many other cytokines (IL-6, G-CSF, GM-CSF, IL-1beta, TGF-beta, and TNF-alpha), chemokines, including IL-8 (CXCL8), GRO-alpha (CXCL1) and MCP-1 (CCL2), and prostaglandins from many cell types (fibroblasts, endothelial cells, epithelial cells, keratinocytes and macrophages).

The Bovine IL-17A protein can be used in cell culture, as an IL-17A ELISA Standard, and as a Western Blot Control.

• Protein Sequence: KAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPE RYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVG CTCVTPIVRHLA (132)
• Alias: Interleukin-17A
• Source: yeast
• Molecular Weight: 15.0 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping