Bovine IL-10 Recombinant Protein

$180.00

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Bovine IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Catalog # Product Size Quantity Price
6501 5 µg $180.00
Catalog #: 6501 Category:

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which consists of nine members: IL-10, IL-19, IL-20, IL-22, IL-24, IL-26, IL-28A, IL-28B, and IL-29. These cytokines elicit diverse host defense mechanisms.

IL-10 family cytokines have indispensable functions in many infectious and inflammatory diseases. IL-10 family cytokines are essential for maintaining the integrity and homeostasis of tissue epithelial layers. By promoting innate immune response, members of this family can limit the damage caused by viral and bacterial infections. They can also facilitate the tissue-healing process in injuries caused by infection or inflammation.

The Bovine IL-10 protein can be used in cell culture, as an IL-10 ELISA Standard, and as a Western Blot Control.

• Protein Sequence: SRDASTLSDSSCIHLPTSLPHMLRELRAAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGYL GCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKA VEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK (160)
• Alias: Interleukin-10
• Source: yeast
• Molecular Weight: 18.6 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping