Bovine IL-1 alpha Recombinant Protein

$180.00

IL-1 alpha (IL-1α, IL-1F1) is a member of the interleukin 1 family of cytokines. IL-1 alpha is an inflammatory cytokine active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. Bovine IL-1 alpha Recombinant Protein is purified interleukin-1 alpha cytokine produced in yeast.

Catalog # Product Size Quantity Price
6412 5 µg $180.00
Catalog #: 6412 Category:

Bovine IL-1 alpha is a member of the interleukin-1 family of cytokines, which encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1 cytokines play key roles in the development and regulation of inflammation. IL-1α (IL-1F1), IL-1β (IL-1F2), and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an ‘alarmin’ released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

The Bovine IL-1 alpha protein can be used in cell culture, as an IL-1 alpha ELISA Standard, and as a Western Blot Control.

• Protein Sequence: SNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQ LPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHP KLFIATKQEKLVHMASGPPSITDFQILEK (149)
• Alias: IL-1F1
• Source: yeast
• Molecular Weight: 17.1 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping