Bovine IFN alpha A Recombinant Protein

$180.00

IFN alpha is a mammalian Type I inferferon, mainly involved in innate immune response against viral infection. Bovine IFN alpha A Recombinant Protein is purified IFN alpha A produced in yeast.

Catalog # Product Size Quantity Price
6365 5 µg $180.00
Catalog #: 6365 Category:

Type I interferons comprise a vast and growing group of IFN proteins. Homologous molecules to type I IFNs are found in many species, including all mammals, and some have been identified in birds, reptiles, amphibians and fish species. The mammalian types are designated IFN-alpha, IFN-beta, IFN-kappa, IFN-delta, IFN-epsilon, IFN-tau, IFN-omega, and IFN-zeta (also known as limitin). They are mainly involved in innate immune response against viral infection. Bovine IFN alpha is for use in cell culture, as an ELISA Standard, and as a Western Blot Control.

The bovine IFN alpha A protein can be used in cell culture, as a IFN alpha ELISA Standard, and as a Western Blot Control.

• Protein Sequence: CHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFEFLQEALGGSQLQKAQAISVLHEV TQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQACLTQEEGLRGAPLLKEDSSLAV RKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD (166)
• Source: yeast
• Molecular Weight: 19.0 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping