Bovine CCL5 Recombinant Protein

$180.00

CCL5, also known as RANTES (regulated and normal T cell expressed and secreted), is a member of the C-C Chemokine Family. RANTES (CCL5) is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. Bovine CCL5 Recombinant Protein is purified CCL5 (RANTES) produced in yeast.

Catalog # Product Size Quantity Price
6394 5 µg $180.00
Catalog #: 6394 Category:

CCL5, also known as RANTES (regulated and normal T cell expressed and secreted), is a member of the C-C Chemokine Family. There are at least 27 distinct members of the C-C subgroup reported for mammals. RANTES (CCL5) is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. CCL5 plays a role in many disease states, including rheumatoid arthritis, HIV, and cancer.

The Bovine RANTES/CCL5 protein can be used in cell culture, as an RANTES/CCL5 ELISA Standard, and as a Western Blot Control.

• Protein Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVRE YINALELS (68)
• Alias: RANTES
• Source: yeast
• Molecular Weight: 7.9 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping