Bovine CCL4 Recombinant Protein

$180.00

The small chemotactic cytokine CCL4 (MIP-1 beta) is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. CCL4 is involved in several inflammatory and autoimmune diseases including viral infection such as HIV-1/AIDS. Bovine CCL4 Recombinant Protein is purified chemokine ligand 4 (CCL4, MIP-1 beta) produced in yeast.

Catalog # Product Size Quantity Price
6491 5 µg $180.00
Catalog #: 6491 Category:

Chemokine ligand 4 (CCL4) is a small chemotactic cytokine belonging to the CC chemokine family that is also known as macrophage inflammatory protein-1β (MIP-1 beta). There are at least 27 distinct members of the C-C subgroup reported for mammals. They are characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL4 (MIP-1 beta) is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. CCL4 is involved in several inflammatory and autoimmune diseases including viral infection such as HIV-1/AIDS.

The Bovine CCL4/MIP-1 beta protein can be used in cell culture, as an CCL4/MIP-1 beta ELISA Standard, and as a Western Blot Control.

• Protein Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQ EYVDDLELN (69)
• Alias: MIP-1 beta
• Source: yeast
• Molecular Weight: 7.8 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping