Bovine CCL2 Recombinant Protein

$180.00

Chemokine (C-C motif) ligand 2 (CCL2), also known as monocyte chemotactic protein-1 (MCP-1), is a small cytokine belonging to the CC chemokine family. CCL2 (MCP-1) recruits monocytes, memory T cells, and dendritic cells to sites of tissue injury and infection. Bovine CCL2 (MCP-1) Recombinant Protein is purified CCL2 (MCP-1) produced in yeast.

Catalog # Product Size Quantity Price
6383 5 µg $180.00
Catalog #: 6383 Category:

Chemokine (C-C motif) ligand 2 (CCL2), also known as monocyte chemotactic protein-1 (MCP-1), is a small cytokine belonging to the CC chemokine family. There are at least 27 distinct members of the C-C subgroup reported for mammals. They are characterized by two adjacent cysteines.

CCL2 (MCP-1) recruits monocytes, memory T cells, and dendritic cells to sites of tissue injury and infection. CCL2 (MCP-1) is implicated in pathogeneses of several diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis.

The Bovine MCP-1 protein can be used in cell culture, as an MCP-1 ELISA Standard, and as a Western Blot Control.

• Protein Sequence: QPDAINSQVACCYTFNSKKISMQRLMNYRRVTSSKCPKEAVIFKTILGKELCADPKQKWVQDSINYLNKKNQTPKP (76)
• Alias: MCP-1
• Source: yeast
• Molecular Weight: 8.8 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping