Bovine CCL11 Recombinant Protein

$180.00

Chemokine ligand 11 (CCL11) belongs to the CC chemokine family and is commonly known as Eotaxin-1. CCL11 (Eotaxin-1) selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergic responses. Bovine CCL11 Recombinant Protein is purified chemokine ligand 11 (CCL11, Eotaxin-1) produced in yeast.

Catalog # Product Size Quantity Price
6401 5 µg $180.00
Catalog #: 6401 Category:

Chemokine ligand 11 (CCL11) belongs to the CC chemokine family and is commonly known as Eotaxin-1. There are at least 27 distinct members of the C-C subgroup reported for mammals. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL11 (Eotaxin-1) selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergic responses. Endothelial cells, smooth muscle cells, epithelial cells, alveolar macrophages and eosinophils are known to produce CCL11 (Eotaxin).

The Bovine CCL11/Eotaxin-1 protein can be used in cell culture, as an Eotaxin-1 ELISA Standard, and as a Western Blot Control.

• Protein Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQN AMEYLNQKSQTLKS (74)
• Alias: Eotaxin-1
• Source: yeast
• Molecular Weight: 8.6 kDa
• Form: Lyophilized
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping