Bovine APRIL Recombinant Protein

$180.00

A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Bovine APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.

Catalog # Product Size Quantity Price
6500 5 µg $180.00
Catalog #: 6500 Category:

A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. Nineteen cytokine ligands have been identified as part of the TNF family on the basis of sequence, functional, and structural similarities. Family members include TNF beta (TNFSF1), TNF alpha (TNFSF2), Lymphotoxin beta (TNFSF3), OX40 Ligand (TNFSF4), CD40 Ligand (TNFSF5), Fas Ligand (TNFSF6), CD27 Ligand (TNFSF7), CD30 Ligand (TNFSF8), 4-1BB Ligand (TNFSF9), TRAIL (TNFSF10), TRANCE/RANKL (TNFSF11), TWEAK (TNFSF12), APRIL(TNFSF13), BAFF (TNFSF13B), LIGHT (TNFSF14), TL1A/VEGI (TNFSF15), and GITR Ligand (TNFSF18).

The TNFSF13 ligand (APRIL) is expressed by macrophages and dendritic cells. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development.

The Bovine APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.
To use, reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

• Protein Sequence: AVLTRKHKKKRSVLHLVPINITSKEDSDVTEVMWQPALQRGRGLEAQGYVVRVWDAGVYL LYSQVLFHDETFTMGQMVSREGQGRQETLFRCIQSMPSNPDWAYNSCYSAGVFHLHQGDI LSVVIPRARAKLSLSPHGTFLGLVKL (146)
• Alias: TNSF13
• Source: yeast
• Purity: >95% as visualized by SDS-PAGE analysis
• Molecular Weight: 16.5 kDa
• Form: Lyophilized without carrier protein
• Contains: Recombinant proteins produced in yeast
• Storage: -20°C
• Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping